hydropeptide

(72 Items)

84685 921257 921257 1 LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. True hydropeptide/hydropeptideliplockhydrator0.24oz.jpg Special Offer Available 21.00 21.00 21.00 False False False False 0.00 False False Diversion contract is required HydroPeptide LipLock Hydrator Peptide Infused Lip Mask provides softer, plumper-looking lips day or night with natural oils that dramatically boost hydration while peptides visibly improve volume and reduce the appearance of lip lines True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask

Promotional ItemLog in to view pricing.
View Sizes
135959 921365 921365 1 Gua Sha Facial Lifting Tool HydroPeptide HydroPeptide Gua Sha Facial Lifting Tool False hydropeptide/HydroPeptideGuaShaFacialLiftingTool.jpg Special Offer Available 12.50 12.50 7.50 True True False False 7.50 False False Diversion contract is required HydroPeptide Gua Sha Facial Lifting Tool deeply massages the skin to decrease fine lines and wrinkles, promote lymphatic drainage, and sculpt the face. False Log in to view pricing. False

HydroPeptide
Gua Sha Facial Lifting Tool

SKU 921365

Promotional ItemLog in to view pricing.
Quick View
50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 29.70 True True False False 29.70 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. False Log in to view pricing. False

HydroPeptide
Nimni Day Cream

1 Fl. Oz.

SKU 921552

Promotional ItemLog in to view pricing.
Quick View
49399 920252 920252 1 PolyPeptide Collagel+ Eye Mask 8 ct. HydroPeptide HydroPeptide PolyPeptide Collagel+ Eye Mask 8 ct. True hydropeptide/hypnewpolypeptidecollageleyemask8ct.jpg Special Offer Available 26.00 26.00 26.00 False False False False 0.00 False False Diversion contract is required HydroPeptide PolyPeptide Collagel+ Eye Mask is a no-mess, easy-to-use eye mask that utilizes hydrogel technology infused with key collagen-supporting peptides and hydrating nutrients to reduce the appearance of fine lines and wrinkles while visibly brightening the area. True Log in to view pricing. False

HydroPeptide
PolyPeptide Collagel+ Eye Mask

Promotional ItemLog in to view pricing.
View Sizes
133317 921373 921373 1 CryoGlobes 2 pc. HydroPeptide HydroPeptide Professional CryoGlobes 2 pc. False hydropeptideprofessional/hydropeptidecryoglobes.jpg Special Offer Available 34.00 34.00 25.00 True True False False 25.00 False False Diversion contract is required The HydroPeptide CryoGlobes provide a new way to enhance your massage techniques for your HydroPeptide facials. True Log in to view pricing. False

HydroPeptide
Professional CryoGlobes

2 pc.

SKU 921373

Promotional ItemLog in to view pricing.
Quick View
168384 921528 921528 1 Perfecting Gloss Display HydroPeptide HydroPeptide Professional Perfecting Gloss Display False hydropeptide/hpperfectingglossdisplay.jpg Special Offer Available 127.27 127.27 76.36 True True False False 76.36 False False Diversion contract is required HydroPeptide Perfecting Gloss Display.
*No Product Included True Log in to view pricing. False

HydroPeptide
Professional Perfecting Gloss Display

SKU 921528

Promotional ItemLog in to view pricing.
Quick View
51065 920258 920258 1 Radiance Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Radiance Mask 0.5 Fl. Oz. False hydropeptide/hpradiancemask.jpg Special Offer Available 24.00 24.00 14.40 True True False False 14.40 False False Diversion contract is required HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. False Log in to view pricing. False

HydroPeptide
Radiance Mask

0.5 Fl. Oz.

SKU 920258

Promotional ItemLog in to view pricing.
Quick View
168363 921536 921536 1 Summer Skin Rescue Kit 5 pc. HydroPeptide HydroPeptide Summer Skin Rescue Kit 5 pc. False hydropeptide/hypsummerskinrescuekit.jpg Special Offer Available 49.50 49.50 35.00 True True False False 35.00 False False Diversion contract is required HydroPeptide Summer Skin Rescue Kit includes serum, moisturizer, treatment, cleanser, and travel bag. False Log in to view pricing. False

HydroPeptide
Summer Skin Rescue Kit

5 pc.

SKU 921536

Promotional ItemLog in to view pricing.
Quick View
39411 920119 920119 1 5X Power Peel 30 pk. HydroPeptide HydroPeptide 5X Power Peel 30 pk. False hydropeptide/HydroP5xPowerPeelUpdate25.jpg Special Offer Available 36.50 36.50 36.50 False False False False 0.00 False False Diversion contract is required Hydropeptide 5X Power Peel resurfaces, clarifies, brightens, and smooths away the appearance of wrinkles with five powerful daily exfoliants. True Log in to view pricing. False

HydroPeptide
5X Power Peel

30 pk.

SKU 920119

Log in to view pricing.
Quick View
156536 921450 921450 1 Age Reversal Regimen 6 pc. HydroPeptide HydroPeptide Age Reversal Regimen 6 pc. False hydropeptide/HydroPeptideAgeReversalRegimen.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required Hydropeptide Age Reversal Regimen features six best-selling products, one holistic routine for visibly rejuvenated skin.
Includes 1 Each:
Exfoliating Cleanser 1 oz.
Power Serum 0.34 oz.
Eye Authority 0.17 oz.
Power Lift Moisturizer 0.17 oz.
Nimni Cream Collagen Complex 0.17 oz.
Solar Defense Tinted SPF 30 0.5 oz.
True Log in to view pricing. False

HydroPeptide
Age Reversal Regimen

6 pc.

SKU 921450

Log in to view pricing.
Quick View
70656 920149 920149 1 Hydraflora Probiotic Essence 4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydraflora Probiotic Essence 4 Fl. Oz. False hydropeptide/hypnewhydraflora4oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydraflora Probiotic Essence Toner is formulated with a powerful pre- and probiotic complex to help maintain healthy microflora and provide skin barrier support. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Hydraflora Probiotic Essence

4 Fl. Oz.

SKU 920149

Log in to view pricing.
Quick View
73646 920356 920356 1 Hydroactive Cleanse Micellar Facial Cloths 30 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 30 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required Remove build-up and deeply purify with HydroPeptide Micellar Cleansing Cloths. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

30 pk.

SKU 920356

Log in to view pricing.
Quick View
70659 920152 920152 1 Hydroactive Cleanse Micellar Facial Cloths 5 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 5 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 50.00 50.00 50.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydroactive Cleanse Micellar Facial Cloths gently remove makeup, debris and pollution while purifying the skin in one sweep. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

5 pk.

SKU 920152

Log in to view pricing.
Quick View
127117 921361 921361 1 Triple Acid Peptide Peel 1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Triple Acid Peptide Peel 1 Fl. Oz. True hydropeptide/hydropeptidetripleacidpeel1oz30ml.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Triple Acid Peptide Peel is a leave-on face peel designed to encourage cell turnover and improve signs of aging. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Triple Acid Peptide Peel

Log in to view pricing.
View Sizes
84664 921254 921254 1 Cashmere Cleanse 6.76 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Cashmere Cleanse 6.76 Fl. Oz. True hydropeptide/hypnewcashmerecleanse6oz.jpg Special Offer Available 27.00 27.00 27.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Cashmere Cleanser is a comforting cleanser that gently whisks away impurities without stripping or drying the skin. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore Cashmere Cleanse

Log in to view pricing.
View Sizes