MarApr26 Promos

hydropeptide

(73 Items)
  • 50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimniâ„¢ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False
    HydroPeptide Nimni Day Cream 1 Fl. Oz.

    HydroPeptide
    Nimni Day Cream

    1 Fl. Oz.

    SKU 921552

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 133317 921373 921373 1 CryoGlobes 2 pc. HydroPeptide HydroPeptide Professional CryoGlobes 2 pc. False hydropeptideprofessional/hydropeptidecryoglobes.jpg Special Offer Available 34.00 34.00 25.00 True True False False 25.00 False False Diversion contract is required The HydroPeptide CryoGlobes provide a new way to enhance your massage techniques for your HydroPeptide facials. True Log in to view pricing. False
    HydroPeptide CryoGlobes 2 pc.

    HydroPeptide
    Professional CryoGlobes

    2 pc.

    SKU 921373

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 51065 920258 920258 1 Radiance Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Radiance Mask 0.5 Fl. Oz. False hydropeptide/hpradiancemask.jpg Special Offer Available 24.00 24.00 14.40 True True False False 14.40 False False Diversion contract is required HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. False Log in to view pricing. False
    HydroPeptide Radiance Mask 0.5 Fl. Oz.

    HydroPeptide
    Radiance Mask

    0.5 Fl. Oz.

    SKU 920258

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 39411 920119 920119 1 5X Power Peel 30 pk. HydroPeptide HydroPeptide 5X Power Peel 30 pk. False hydropeptide/HydroP5xPowerPeelUpdate25.jpg Special Offer Available 36.50 36.50 36.50 False False False False 0.00 False False Diversion contract is required Hydropeptide 5X Power Peel resurfaces, clarifies, brightens, and smooths away the appearance of wrinkles with five powerful daily exfoliants. True Log in to view pricing. False
    HydroPeptide 5X Power Peel 30 pk.

    HydroPeptide
    5X Power Peel

    30 pk.

    SKU 920119

    Bonus Offer
    Quick View
  • 156536 921450 921450 1 Age Reversal Regimen 6 pc. HydroPeptide HydroPeptide Age Reversal Regimen 6 pc. False hydropeptide/HydroPeptideAgeReversalRegimen.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required Hydropeptide Age Reversal Regimen features six best-selling products, one holistic routine for visibly rejuvenated skin.
    Includes 1 Each:
    Exfoliating Cleanser 1 oz.
    Power Serum 0.34 oz.
    Eye Authority 0.17 oz.
    Power Lift Moisturizer 0.17 oz.
    Nimni Cream Collagen Complex 0.17 oz.
    Solar Defense Tinted SPF 30 0.5 oz.
    True Log in to view pricing. False
    HydroPeptide Age Reversal Regimen 6 pc.

    HydroPeptide
    Age Reversal Regimen

    6 pc.

    SKU 921450

    Bonus Offer
    Quick View
  • 70656 920149 920149 1 Hydraflora Probiotic Essence 4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydraflora Probiotic Essence 4 Fl. Oz. False hydropeptide/hypnewhydraflora4oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydraflora Probiotic Essence Toner is formulated with a powerful pre- and probiotic complex to help maintain healthy microflora and provide skin barrier support. True Log in to view pricing. False
    HydroPeptide Hydraflora Probiotic Essence 4 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Detox Hydraflora Probiotic Essence

    4 Fl. Oz.

    SKU 920149

    Bonus Offer
    Quick View
  • 73646 920356 920356 1 Hydroactive Cleanse Micellar Facial Cloths 30 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 30 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required Remove build-up and deeply purify with HydroPeptide Micellar Cleansing Cloths. False Log in to view pricing. False
    HydroPeptide Hydroactive Cleanse Micellar Facial Cloths 30 pk.

    HydroPeptide
    Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

    30 pk.

    SKU 920356

    Bonus Offer
    Quick View
  • 70659 920152 920152 1 Hydroactive Cleanse Micellar Facial Cloths 5 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 5 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 50.00 50.00 50.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydroactive Cleanse Micellar Facial Cloths gently remove makeup, debris and pollution while purifying the skin in one sweep. True Log in to view pricing. False
    HydroPeptide Hydroactive Cleanse Micellar Facial Cloths 5 pk.

    HydroPeptide
    Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

    5 pk.

    SKU 920152

    Bonus Offer
    Quick View
  • 127117 921361 921361 1 Triple Acid Peptide Peel 1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Triple Acid Peptide Peel 1 Fl. Oz. True hydropeptide/hydropeptidetripleacidpeel1oz30ml.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Triple Acid Peptide Peel is a leave-on face peel designed to encourage cell turnover and improve signs of aging. False Log in to view pricing. False
    HydroPeptide Triple Acid Peptide Peel 1 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Detox Triple Acid Peptide Peel

    Bonus Offer
    View Sizes
  • 84664 921254 921254 1 Cashmere Cleanse 6.76 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Cashmere Cleanse 6.76 Fl. Oz. True hydropeptide/hypnewcashmerecleanse6oz.jpg Special Offer Available 27.00 27.00 27.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Cashmere Cleanser is a comforting cleanser that gently whisks away impurities without stripping or drying the skin. True Log in to view pricing. False
    HydroPeptide Cashmere Cleanse 6.76 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Cashmere Cleanse

    Bonus Offer
    View Sizes
  • 84669 921255 921255 1 Hydro-Lock Sleep Mask 2.5 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask 2.5 Fl. Oz. True hydropeptide/newhydropeptidehydrolocksleepmask2.5oz.jpg Special Offer Available 44.00 44.00 44.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydro-Lock Sleep Mask is an overnight, pillow-proof treatment that smooths and perfects skin with a layer of intense, restorative hydration while encouraging cell turnover and providing vital nutrients to leave skin radiant, refreshed, and soft. False Log in to view pricing. False
    HydroPeptide Hydro-Lock Sleep Mask 2.5 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Hydro-Lock Sleep Mask

    Bonus Offer
    View Sizes
  • 84685 921257 921257 1 LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. True hydropeptide/hydropeptideliplockhydrator0.24oz.jpg Special Offer Available 21.00 21.00 21.00 False False False False 0.00 False False Diversion contract is required HydroPeptide LipLock Hydrator Peptide Infused Lip Mask provides softer, plumper-looking lips day or night with natural oils that dramatically boost hydration while peptides visibly improve volume and reduce the appearance of lip lines True Log in to view pricing. False
    HydroPeptide LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask

    Bonus Offer
    View Sizes
  • 84702 921259 921259 1 Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz. True hydropeptide/newhydropeptidemakeupmelt3.4oz.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Makeup Melt Botanical Cleansing Balm is infused with specialized cleansing extracts and botanicals that melt away all traces of stubborn makeup and impurities without drying or irritating skin. False Log in to view pricing. False
    HydroPeptide Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Makeup Melt Botanical Cleansing Balm

    Bonus Offer
    View Sizes
  • 84693 921258 921258 1 Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz. True hydropeptide/newhydropeptidemoisturereset1oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Moisture Reset Phytonutrient Facial Oil is an antioxidant-rich blend of 12 precious oils makes up this nutrient-rich, fast-absorbing facial oil. True Log in to view pricing. False
    HydroPeptide Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Moisture Reset Phytonutrient Facial Oil

    Bonus Offer
    View Sizes
  • 39528 920116 920116 1 Aquaboost 1 Fl. Oz. HydroPeptide HydroPeptide Aquaboost 1 Fl. Oz. False hydropeptide/newhypaquaboost1oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Aquaboost is a lightweight, oil-free moisturizer is thoughtfully formulated for oily and acne-prone skin. False Log in to view pricing. False
    HydroPeptide Aquaboost 1 Fl. Oz.

    HydroPeptide
    Aquaboost

    1 Fl. Oz.

    SKU 920116

    Bonus Offer
    Quick View
(73 Items)