hydropeptide

150335 921442 921442 1 PolyPeptide Collagel + Lip Mask 8 pc. HydroPeptide HydroPeptide Anti-Wrinkle + Restore PolyPeptide Collagel + Lip Mask 8 pc. False hydropeptide/HydroPeptidePolishPolyPeptideCollagelLipMask.jpg Special Offer Available 28.00 28.00 15.00 True True False False 15.00 False False Diversion contract is required 0 HydroPeptide's PolyPeptide Collagel + Lip Mask is a renewing lip treatment designed to offer a surge of nourishment and hydration to dry, lackluster lips. True Log in to view pricing. False

161602 921502 921502 1 Glow Like a Pro Set 6 pc. HydroPeptide HydroPeptide Glow Like a Pro Set 6 pc. False hydropeptide/hypglowlikeaprokitupdate.jpg Special Offer Available 42.00 42.00 16.80 True True False False 16.80 False False Diversion contract is required 0 HydroPeptide Glow Like a Pro Set is for radical brightening benefits and renewed radiance in minutes. True Log in to view pricing. False

152730 921456 921456 1 Glow Revive Body Wash 8 Fl. Oz. HydroPeptide HydroPeptide Glow Revive Body Wash 8 Fl. Oz. False hydropeptide/newhypbrighteningbodycollectionglowrevive8oz.jpg Special Offer Available 22.50 22.50 17.50 True True False False 17.50 False False Diversion contract is required 0 HydroPeptide Glow Revive Body Wash cleanses, brightens, exfoliates, and uses the revitalizing power of caffeine alongside shikimic acid, a gentle yet highly effective chemical exfoliant that boasts 10 times the biological activity of glycolic acid, to deeply nourish and visibly rejuvenate skin. True Log in to view pricing. False

145578 921425 921425 1 Liquid Resurfacing Solution 4 Fl. Oz. HydroPeptide HydroPeptide Liquid Resurfacing Solution 4 Fl. Oz. True noimage.png Special Offer Available 24.50 24.50 24.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Liquid Resurfacing Solution is a lightweight, leave-on exfoliant that partners 2% salicylic acid and potent antioxidants with patented CellRenew-16 technology to visibly improve skin tone and texture without compromising the skin's moisture barrier. True Log in to view pricing. False

42471 920132 920132 1 Nimni Cream 0.5 Fl. Oz. HydroPeptide HydroPeptide Nimni Cream 0.5 Fl. Oz. True hydropeptide/newhydropeptidenimnicream05oz.jpg Special Offer Available 56.00 56.00 40.00 True True False False 40.00 False False Diversion contract is required 0 HydroPeptide Nimni Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

50655 920257 920257 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 56.00 56.00 40.00 True True False False 40.00 False False Diversion contract is required 0 HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

144014 921412 921412 1 Retinol Eye Renewal 0.5 Fl. Oz. HydroPeptide HydroPeptide Retinol Eye Renewal 0.5 Fl. Oz. True hydropeptide/HYPNewRetinolEyeRenewalHalfOunce.jpg Special Offer Available 65.00 65.00 65.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Retinol Eye Renewal is for anyone looking to achieve firmer, brighter, more youthful under-eyes. True Log in to view pricing. False

168363 921536 921536 1 Summer Skin Rescue Kit 5 pc. HydroPeptide HydroPeptide Summer Skin Rescue Kit 5 pc. False hydropeptide/hypsummerskinrescuekit.jpg Special Offer Available 49.50 49.50 49.50 False True Valid Thru 04/30/25 False False 0.00 False False Diversion contract is required 0 HydroPeptide Summer Skin Rescue Kit includes serum, moisturizer, treatment, cleanser, and travel bag. True Log in to view pricing. False

168357 921534 921534 1 Sun Slick 0.52 Fl. Oz. HydroPeptide HydroPeptide Sun Slick 0.52 Fl. Oz. False hydropeptide/hydropeptidesunslickstick2025.jpg Special Offer Available 19.00 19.00 19.00 False True Valid Thru 04/30/25 False False 0.00 False False Diversion contract is required 0 HydroPeptide Sun Slick is enriched with reparative peptides, hydrating lipids, and SPF-supporting ingredients, making this is your ultimate companion for healthy, protected skin at home or on the go. True Log in to view pricing. False