Holiday Assets Ongoing

dermalogica eye treatments

(7 Items)
  • 19139 111033 111033 1 multivitamin power firm 0.5 Fl. Oz. Dermalogica Dermalogica age smart multivitamin power firm 0.5 Fl. Oz. True dermalogica/111033dermalogicamultivitaminpowerfirmtube.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required 0 Dermalogica age smart multivitamin power firm combats lines around the delicate eye area while increasing skin's firmness and elasticity. True Log in to view pricing. False
    Dermalogica multivitamin power firm 0.5 Fl. Oz.

    Dermalogica
    age smart multivitamin power firm

    Bonus Offer
    View Sizes
  • 127310 111449 111449 1 awaken peptide eye gel 0.5 Fl. Oz. Dermalogica Dermalogica awaken peptide eye gel 0.5 Fl. Oz. False dermalogica/dermalogicaawakenpeptideeyegel05oz.jpg Special Offer Available 29.50 29.50 29.50 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False
    Dermalogica awaken peptide eye gel 0.5 Fl. Oz.

    Dermalogica
    awaken peptide eye gel

    0.5 Fl. Oz.

    SKU 111449

    Bonus Offer
    Quick View
  • 135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE False dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.40 0.40 0.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False
    Dermalogica awaken peptide eye gel SAMPLE

    Dermalogica
    awaken peptide eye gel

    SAMPLE

    SKU 611449

    Bonus Offer
    Quick View
  • 89475 111393 111393 1 biolumin-c eye serum 0.5 Fl. Oz. Dermalogica Dermalogica biolumin-c eye serum 0.5 Fl. Oz. True dermalogica/111393dermalogicabioluminceyeserumtube.jpg Special Offer Available 37.00 37.00 37.00 False False False False 0.00 False False Diversion contract is required 0 Dermalogica Age Smart biolumin-c eye serum outsmarts visible premature skin aging caused by daily eye movements and environmental stress. True Log in to view pricing. False
    Dermalogica biolumin-c eye serum 0.5 Fl. Oz.

    Dermalogica
    biolumin-c eye serum

    Bonus Offer
    View Sizes
  • 42432 111257 111257 1 stress positive eye lift 0.85 Fl. Oz. Dermalogica Dermalogica daily skin health stress positive eye lift 0.85 Fl. Oz. False dermalogica/111257dermalogicastresspositiveeyelifttube.jpg Special Offer Available 38.00 38.00 38.00 False False False False 0.00 False False Diversion contract is required 0 Dermalogica stress positive eye lift is a de-puffing eye treatment and masque. True Log in to view pricing. False
    Dermalogica stress positive eye lift 0.85 Fl. Oz.

    Dermalogica
    daily skin health stress positive eye lift

    0.85 Fl. Oz.

    SKU 111257

    Bonus Offer
    Quick View
  • 156435 111487 111487 1 phyto nature lifting eye cream 0.5 Fl. Oz. Dermalogica Dermalogica phyto nature lifting eye cream 0.5 Fl. Oz. True dermalogica/dermologica-phytonatureliftingeyecream0.5oz.jpg Special Offer Available 57.50 57.50 57.50 False False False False 0.00 False False Diversion contract is required 0 Dermalogica phyto nature lifting eye cream is a firming + lifting eye treatment. True Log in to view pricing. False
    Dermalogica phyto nature lifting eye cream 0.5 Fl. Oz.

    Dermalogica
    phyto nature lifting eye cream

    Bonus Offer
    View Sizes
  • 156436 711487 711487 1 phyto nature lifting eye cream TESTER 0.5 Fl. Oz. Dermalogica Dermalogica phyto nature lifting eye cream TESTER 0.5 Fl. Oz. False noimage.png Special Offer Available 56.50 56.50 56.50 False False False False 0.00 False False Diversion contract is required 0 Dermalogica phyto nature lifting eye cream is a firming + lifting eye treatment. True Log in to view pricing. False

    Dermalogica
    phyto nature lifting eye cream TESTER

    0.5 Fl. Oz.

    SKU 711487

    Bonus Offer
    Quick View
(7 Items)