travel/minis skin & body

19327 611596 611596 4 active moist SAMPLE Dermalogica Dermalogica active moist SAMPLE dermalogica/611596dermalogicaactivemoisttube.jpg Special Offer Available 0.20 0.20 0.20 False False False False 0.00 False False Diversion contract is required 0 Dermologica active moist is a light, oil-free lotion that helps improve skin texture and combat surface dehydration. True Log in to view pricing. False

135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.40 0.40 0.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

130309 611455 611455 1 Circular Hydration Serum Sample 0.03 Fl. Oz. Dermalogica Dermalogica Circular Hydration Serum Sample 0.03 Fl. Oz. dermalogica/dermalogicacircularhydrationserumsample.jpg Special Offer Available 0.40 0.40 0.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica circular hydration serum immediately floods skin with hydration, replenishes from within, and helps prevent future hydration evaporation. True Log in to view pricing. False

120828 611439 611439 1 daily glycolic cleanser SAMPLE Dermalogica Dermalogica daily glycolic cleanser SAMPLE dermalogica/demalogicadailyglycoliccleansersample.jpg Special Offer Available 0.40 0.40 0.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica daily glycolic cleanser is a brightening and conditioning cleanser that renews dull, uneven skin tone and helps remove buildup caused by environmental factors. True Log in to view pricing. False

19307 111248 111248 1 daily microfoliant - travel bright 0.45 Fl. Oz. Dermalogica Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz. dermalogica/dermalogicadailymicrofoliant045oz.jpg Special Offer Available 13.30 13.30 13.30 False False False False 13.30 False False Diversion contract is required 0 Dermalogica daily microfoliant is a gentle, daily use exfoliating powder that sloughs away dead skin cells, instantly leaving skin smoother and brighter. For use with all skin conditions. True Log in to view pricing. False

133384 411453 411453 1 daily milkfoliant 0.45 Fl. Oz. Dermalogica Dermalogica daily milkfoliant 0.45 Fl. Oz. dermalogica/dermalogicadailymilkfoliant045oz.jpg Special Offer Available 13.30 13.30 13.30 False False False False 13.30 False False Diversion contract is required 0 Make peace with daily exfoliation. Dermalogica's daily milkfoliant exfoliator gently polishes to reveal smoother, more vibrant skin, replenishes and restores skin's moisture barrier and relieves skin with calming and soothing ingredients. True Log in to view pricing. False

141352 611465 611465 1 retinol serum SAMPLE Dermalogica Dermalogica dynamic skin retinol serum SAMPLE dermalogica/dermalogicadynamicskinretinolserumsample.jpg Special Offer Available 0.70 0.70 0.70 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's dynamic skin retinol serum is a high-dose, fast-acting multi-retinoid with booster technology that helps reverse the appearance of wrinkles, retexturize skin and minimize the appearance of pores, and even skin tone. True Log in to view pricing. False

145276 911474-10 911474-10 1 oil to foam total cleanser 0.5 Fl. Oz. Dermalogica Dermalogica oil to foam total cleanser 0.5 Fl. Oz. dermalogica/dermalogicaoiltofoamtotalcleanser05oz.jpg Special Offer Available 8.40 8.40 8.40 False False False False 8.40 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. True Log in to view pricing. False

145276 611474 611474 1 oil to foam total cleanser SAMPLE Dermalogica Dermalogica oil to foam total cleanser SAMPLE dermalogica/dermalogicaoiltofoamtotalcleansersample.jpg Special Offer Available 0.60 0.60 0.60 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. True Log in to view pricing. False

144615 611466 611466 1 phyto nature oxygen liquid cream 0.07 Fl. Oz. Dermalogica Dermalogica phyto nature oxygen liquid cream 0.07 Fl. Oz. dermalogica/dermalogicaphytonatureoxygencreamsample.jpg Special Offer Available 0.40 0.40 0.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's phyto nature oxygen cream is a reawakening daily liquid moisturizer that firms, lifts, and revitalizes with premium hydrating and oxygen-optimizing phytoactives. True Log in to view pricing. False

67732 111325 111325 1 skin smoothing cream 0.5 Fl. Oz. Dermalogica Dermalogica skin smoothing cream 0.5 Fl. Oz. dermalogica/111325dermalogicaskinsmoothingcreamtube.jpg Special Offer Available 12.25 12.25 12.25 False False False False 12.25 False False Diversion contract is required 0 Now with a continuous 48 hours of hydration, skin smoothing cream with Active Hydramesh Technology improves skin hydration by 80%, protects against environmental factors, and locks in moisture. True Log in to view pricing. False

122122 29443 29443 1 Wash Me All Over Hand & Body Wash 1.7 Fl. Oz. ELEVEN Australia ELEVEN Australia Wash Me All Over Hand & Body Wash 1.7 Fl. Oz. elevenaustralia/elevenWashMeAllOverHandBodyWash1.7floz.jpg Special Offer Available 4.50 4.50 4.50 False False False False 0.00 False False Diversion contract is required 0 ELEVEN Australia Wash Me All Over Hand & Body Wash is a SLS free formula with a blend of papaya, jojoba oil and sweet almond oil. True Log in to view pricing. False

84664 921296 921296 1 Cashmere Cleanse Travel 1.6 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Cashmere Cleanse Travel 1.6 Fl. Oz. hydropeptide/cashmerecleansetravel2.jpg Special Offer Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Cashmere Cleanse Facial Rose Milk is a comforting cleanser that gently whisks away daytime impurities without stripping or drying the skin. True Log in to view pricing. False

84669 921255 921255 1 Hydro-Lock Sleep Mask 2.53 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask 2.53 Fl. Oz. hydropeptide/hphydrolocksleepmask.jpg Special Offer Available 44.00 44.00 44.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask Royal Peptide Treatment is a luxurious sleeping mask that blankets the contours of skin with a layer of intense, restorative hydration. True Log in to view pricing. False

84702 921470 921470 1 Makeup Melt Botanical Cleansing Balm 0.5 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Makeup Melt Botanical Cleansing Balm 0.5 Fl. Oz. hydropeptide/hydropeptidemakeupmelt0.5floz.jpg Special Offer Available 8.18 8.18 8.18 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide's Makeup Melt Botanical Cleansing Balm is a transformative makeup remover is infused with specialized cleansing extracts and botanicals that completely remove all traces of stubborn makeup and impurities without drying or irritating skin. False Log in to view pricing. False