skin & body skin care

50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. False Log in to view pricing. False

HydroPeptide
Nimni Day Cream

1 Fl. Oz.

SKU 921552

Promotional ItemLog in to view pricing.

Quick View

179098 422430 422430 1 Collagen Rich Cream 13.5 Fl. Oz. Comfort Zone Comfort Zone Body Strategist Professional Collagen Rich Cream 13.5 Fl. Oz. False comfortzone/comfortzoneprobodystrategistcollagenrichcream13.5oz.jpg Special Offer Available 79.00 79.00 79.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Body Strategist Professional Collagen Rich Cream is a rich, massageable cream that melts into the skin to deliver nourishment and firmness. True Log in to view pricing. False

Comfort Zone
Body Strategist Professional Collagen Rich Cream

13.5 Fl. Oz.

SKU 422430

Log in to view pricing.

Quick View

172880 422408 422408 1 Cream 1.69 Fl. Oz. Comfort Zone Comfort Zone Luminant Cream 1.69 Fl. Oz. False comfortzone/comfortzoneluminantcream.jpg Special Offer Available 49.00 49.00 49.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Luminant Cream is an illuminating correcting cream. True Log in to view pricing. False

Comfort Zone
Luminant Cream

1.69 Fl. Oz.

SKU 422408

Log in to view pricing.

Quick View

151607 412340 412340 1 Cream 2.02 Fl. Oz. Comfort Zone Comfort Zone Luminant Cream 2.02 Fl. Oz. True comfortzone/comfortzoneluminantcream.jpg Special Offer Available 49.00 49.00 49.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Luminant Cream gives your skin instant luminosity and makes the face look immediately more radiant. True Log in to view pricing. False

Comfort Zone
Luminant Cream

Log in to view pricing.

View Sizes

172881 422409 422409 1 Cream Refill 1.69 Fl. Oz. Comfort Zone Comfort Zone Luminant Cream Refill 1.69 Fl. Oz. False comfortzone/comfortzoneluminantcreamrefill.jpg Special Offer Available 41.00 41.00 41.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Luminant Cream Refill is an illuminating correcting cream. True Log in to view pricing. False

Comfort Zone
Luminant Cream Refill

1.69 Fl. Oz.

SKU 422409

Log in to view pricing.

Quick View

151617 420755 420755 1 Cream 6.76 Fl. Oz. Comfort Zone Comfort Zone Luminant Professional Cream 6.76 Fl. Oz. False comfortzoneprofessional/comfortzoneprond23cream.jpg Special Offer Available 70.00 70.00 70.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Professional Luminant Cream gives your skin instant luminosity and makes the face look immediately more radiant. True Log in to view pricing. False

Comfort Zone
Luminant Professional Cream

6.76 Fl. Oz.

SKU 420755

Log in to view pricing.

Quick View

126747 420705 420705 1 Peel-Off Mask Comfort Zone Comfort Zone Professional Peel-Off Mask False comfortzoneprofessional/comfortzoneprofessionalsublimeskinpeeloffmask.jpg Special Offer Available 63.50 63.50 63.50 False False False False 0.00 False False Diversion contract is required Comfort Zone Professional Sublime Skin Peel-Off Mask includes tubs and sachets. True Log in to view pricing. False

Comfort Zone
Professional Peel-Off Mask

SKU 420705

Log in to view pricing.

Quick View

50998 B2829 B2829 1 1.85 HA Booster Sample Pack 20 ct. Comfort Zone Comfort Zone Skin Regimen Lx 1.85 HA Booster Sample Pack 20 ct. False comfortzone/czskinregimenhaboosterpacket.jpg Special Offer Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Skin Regimen/Lx is a modern skincare system, clinically proven to reduce the effects of stress and lifestyle aging on both skin and mind. Working at the cellular level, it recreates and maintains the optimal conditions for a healthy, youthful, glowy skin, while also empowering the overall mind-skin stress-response. Part of Step 3 of the Skin Regimen is to correct with the 1.85 HA Booster, a hydra-plumping concentrate. True Log in to view pricing. False

Comfort Zone
Skin Regimen Lx 1.85 HA Booster Sample Pack

20 ct.

SKU B2829

Log in to view pricing.

Quick View

161107 412490 412490 1 Caffeine Eye Cream 0.51 Fl. Oz. Comfort Zone Comfort Zone Skin Regimen Lx Caffeine Eye Cream 0.51 Fl. Oz. False skinregimen/skinregimenlxcaffeineeyecream0.51oz.jpg Special Offer Available 43.50 43.50 43.50 False False False False 0.00 False False Diversion contract is required Skin Regimen/Lx Caffeine Eye Cream is a multi-action eye cream that is ideal for correcting the appearance of crow's feet, puffiness, dark circles, and droopy eyelids. True Log in to view pricing. False

Comfort Zone
Skin Regimen Lx Caffeine Eye Cream

0.51 Fl. Oz.

SKU 412490

Log in to view pricing.

Quick View

161145 412406 412406 1 Multi Acid Ampoule 7 x 0.07 Fl. Oz. Comfort Zone Comfort Zone Skin Regimen Lx Multi Acid Ampoule 7 x 0.07 Fl. Oz. False skinregimen/skinregimenlxmultiacidampoule.jpg Special Offer Available 32.50 32.50 32.50 False False False False 0.00 False False Diversion contract is required Comfort Zone Skin Regimen/Lx Multi Acid Ampoule is an anti-aging clearing concentrate that has anti-blemish and anti-aging benefits. True Log in to view pricing. False

Comfort Zone
Skin Regimen Lx Multi Acid Ampoule

7 x 0.07 Fl. Oz.

SKU 412406

Log in to view pricing.

Quick View

161047 412488 412488 1 Night Renewal Cream 1.84 Fl. Oz. Comfort Zone Comfort Zone Skin Regimen Lx Night Renewal Cream 1.84 Fl. Oz. False skinregimen/skinregimenlxnightrenewalcream1.69oz.jpg Special Offer Available 54.50 54.50 54.50 False False False False 0.00 False False Diversion contract is required Comfort Zone Skin Regimen/Lx Night Renewal Cream is an overnight pro-vitality cream gel. True Log in to view pricing. False

Comfort Zone
Skin Regimen Lx Night Renewal Cream

1.84 Fl. Oz.

SKU 412488

Log in to view pricing.

Quick View

161043 412491 412491 1 Polypeptide Rich Cream 1.77 Fl. Oz. Comfort Zone Comfort Zone Skin Regimen Lx Polypeptide Rich Cream 1.77 Fl. Oz. False skinregimen/skinregimenlxpolypeptiderichcream.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Skin Regimen/Lx Polypeptide Rich Cream is an anti-aging firming rich cream. True Log in to view pricing. False

Comfort Zone
Skin Regimen Lx Polypeptide Rich Cream

1.77 Fl. Oz.

SKU 412491

Log in to view pricing.

Quick View

161127 420768 420768 1 Tripeptide Gel Cream 8.45 Fl. Oz. Comfort Zone Comfort Zone Skin Regimen Lx Professional Tripeptide Gel Cream 8.45 Fl. Oz. False skinregimen/skinregimenlxtripeptide-gel-cream-8.45oz.jpg Special Offer Available 105.50 105.50 105.50 False False False False 0.00 False False Diversion contract is required Comfort Zone Skin Regimen/Lx Professional Tripeptide Gel Cream is an anti-aging lifting gel cream that firms and hydrates. False Log in to view pricing. False

Comfort Zone
Skin Regimen Lx Professional Tripeptide Gel Cream

8.45 Fl. Oz.

SKU 420768

Log in to view pricing.

Quick View

51000 B2831 B2831 1 Tripeptide Cream Sample Pack 20 ct. Comfort Zone Comfort Zone Skin Regimen Lx Tripeptide Cream Sample Pack 20 ct. False comfortzone/czskinregimentripeptidecreampacket.jpg Special Offer Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Skin Regimen/Lx is a modern skincare system, clinically proven to reduce the effects of stress and lifestyle aging on both skin and mind. Working at the cellular level, it recreates and maintains the optimal conditions for a healthy, youthful, glowy skin, while also empowering the overall mind-skin stress-response. Part of Step 3 of the Skin Regimen is to correct with Tripeptide Cream / Age-Defense Moisturizer. True Log in to view pricing. False

Comfort Zone
Skin Regimen Lx Tripeptide Cream Sample Pack

20 ct.

SKU B2831

Log in to view pricing.

Quick View

160939 412487 412487 1 Tripeptide Gel Cream 1.69 Fl. Oz. Comfort Zone Comfort Zone Skin Regimen Lx Tripeptide Gel Cream 1.69 Fl. Oz. False skinregimen/skinregimenlxtripeptidegelcream1.69oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Skin Regimen/Lx Tripeptide Gel Cream is an anti-aging lifting gel cream that provides protection against environmental stressors and preserves hydration and tone. True Log in to view pricing. False

Comfort Zone
Skin Regimen Lx Tripeptide Gel Cream

1.69 Fl. Oz.

SKU 412487

Log in to view pricing.

Quick View

Comfort Zone
Body Strategist Professional Collagen Rich Cream

Comfort Zone
Luminant Cream

Comfort Zone
Luminant Cream

Comfort Zone
Luminant Cream Refill

Comfort Zone
Luminant Professional Cream

Comfort Zone
Professional Peel-Off Mask

Comfort Zone
Skin Regimen Lx 1.85 HA Booster Sample Pack

Comfort Zone
Skin Regimen Lx Caffeine Eye Cream

Comfort Zone
Skin Regimen Lx Multi Acid Ampoule

Comfort Zone
Skin Regimen Lx Night Renewal Cream

Comfort Zone
Skin Regimen Lx Polypeptide Rich Cream

Comfort Zone
Skin Regimen Lx Professional Tripeptide Gel Cream

Comfort Zone
Skin Regimen Lx Tripeptide Cream Sample Pack

Comfort Zone
Skin Regimen Lx Tripeptide Gel Cream

Volume Pricing

Product Pack

skin & body skin care

HydroPeptideNimni Day Cream

Comfort ZoneBody Strategist Professional Collagen Rich Cream

Comfort ZoneLuminant Cream

Comfort ZoneLuminant Cream

Comfort ZoneLuminant Cream Refill

Comfort ZoneLuminant Professional Cream

Comfort ZoneProfessional Peel-Off Mask

Comfort ZoneSkin Regimen Lx 1.85 HA Booster Sample Pack

Comfort ZoneSkin Regimen Lx Caffeine Eye Cream

Comfort ZoneSkin Regimen Lx Multi Acid Ampoule

Comfort ZoneSkin Regimen Lx Night Renewal Cream

Comfort ZoneSkin Regimen Lx Polypeptide Rich Cream

Comfort ZoneSkin Regimen Lx Professional Tripeptide Gel Cream

Comfort ZoneSkin Regimen Lx Tripeptide Cream Sample Pack

Comfort ZoneSkin Regimen Lx Tripeptide Gel Cream

Processing Your Request

HydroPeptide
Nimni Day Cream

Comfort Zone
Body Strategist Professional Collagen Rich Cream

Comfort Zone
Luminant Cream

Comfort Zone
Luminant Cream

Comfort Zone
Luminant Cream Refill

Comfort Zone
Luminant Professional Cream

Comfort Zone
Professional Peel-Off Mask

Comfort Zone
Skin Regimen Lx 1.85 HA Booster Sample Pack

Comfort Zone
Skin Regimen Lx Caffeine Eye Cream

Comfort Zone
Skin Regimen Lx Multi Acid Ampoule

Comfort Zone
Skin Regimen Lx Night Renewal Cream

Comfort Zone
Skin Regimen Lx Polypeptide Rich Cream

Comfort Zone
Skin Regimen Lx Professional Tripeptide Gel Cream

Comfort Zone
Skin Regimen Lx Tripeptide Cream Sample Pack

Comfort Zone
Skin Regimen Lx Tripeptide Gel Cream