Mar/Apr 25 Promos

skin & body skin care

(34 Items)
  • 39074 410991 410991 1 Corrector 0.5 Fl. Oz. Comfort Zone Comfort Zone Active Pureness Corrector 0.5 Fl. Oz. False comfortzone/activepurenesscorrectorretail.jpg Special Offer Available 21.00 21.00 20.00 True True False False 20.00 False False Diversion contract is required 0 Comfort Zone Active Pureness Corrector is a targeted imperfection corrector for skin blemishes and acne prone skin. True Log in to view pricing. False
    Comfort Zone Corrector 0.5 Fl. Oz.

    Comfort Zone
    Active Pureness Corrector

    0.5 Fl. Oz.

    SKU 410991

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 68043 420558 420558 1 Acid Preparator 10.14 Fl. Oz. Comfort Zone Comfort Zone Sublime Skin Professional Acid Preparator 10.14 Fl. Oz. False comfortzoneprofessional/czsublimeacid.jpg Special Offer Available 37.50 37.50 30.00 True True False False 30.00 False False Diversion contract is required 0 Comfort Zone Sublime Skin Acid Preparator. True Log in to view pricing. False
    Comfort Zone Acid Preparator 10.14 Fl. Oz.

    Comfort Zone
    Sublime Skin Professional Acid Preparator

    10.14 Fl. Oz.

    SKU 420558

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 126744 420716 420716 1 Neutralizer 9.47 Fl. Oz. Comfort Zone Comfort Zone Sublime Skin Professional Neutralizer 9.47 Fl. Oz. False comfortzoneprofessional/comfortzonesublimeskinneutralizer9oz.jpg Special Offer Available 37.50 37.50 30.00 True True False False 30.00 False False Diversion contract is required 0 Comfort Zone Professional Sublime Skin Neutralizer is an arginine solution which, due to its affinity with the skin, gently neutralizes the activity of the alpha-hydroxy acids and restores the physiological skin pH. True Log in to view pricing. False
    Comfort Zone Neutralizer 9.47 Fl. Oz.

    Comfort Zone
    Sublime Skin Professional Neutralizer

    9.47 Fl. Oz.

    SKU 420716

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 145578 921425 921425 1 Liquid Resurfacing Solution 4 Fl. Oz. HydroPeptide HydroPeptide Liquid Resurfacing Solution 4 Fl. Oz. True noimage.png Special Offer Available 24.50 24.50 24.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Liquid Resurfacing Solution is a lightweight, leave-on exfoliant that partners 2% salicylic acid and potent antioxidants with patented CellRenew-16 technology to visibly improve skin tone and texture without compromising the skin's moisture barrier. True Log in to view pricing. False

    HydroPeptide
    Liquid Resurfacing Solution

    Bonus Offer
    Promotional ItemLog in to view pricing.
    View Sizes
  • 50999 B2830 B2830 1 1.5 Retinol Booster Sample Pack 20 ct. Skin Regimen Lx Skin Regimen Lx 1.5 Retinol Booster Sample Pack 20 ct. False comfortzone/czskinregimenretinolboosterpacket.jpg Special Offer Available 10.00 10.00 6.00 True True False False 6.00 False False Diversion contract is required 0 Skin Regimen is a modern skincare system, clinically proven to reduce the effects of stress and lifestyle aging on both skin and mind. Working at the cellular level, it recreates and maintains the optimal conditions for a healthy, youthful, glowy skin, while also empowering the overall mind-skin stress-response. Part of Step 3 of the Skin Regimen is to correct, with the 1.5 Retinol Booster / wrinkle concentrate. True Log in to view pricing. False
    Skin Regimen Lx 1.5 Retinol Booster Sample Pack 20 ct.

    Skin Regimen Lx
    1.5 Retinol Booster Sample Pack

    20 ct.

    SKU B2830

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 135656 412292 412292 1 Bright & Smooth Ampoule 7 x 0.07 Fl. Oz. Comfort Zone Comfort Zone Renight Bright & Smooth Ampoule 7 x 0.07 Fl. Oz. False comfortzone/comfortzonebrightandsmoothampuleprodid135656.jpg Special Offer Available 26.00 26.00 26.00 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Renight Bright & Smooth Ampoule's offer a nighttime multivitamin concentrate with a smoothing and brightening action for the face and eye area. True Log in to view pricing. False
    Comfort Zone Bright & Smooth Ampoule 7 x 0.07 Fl. Oz.

    Comfort Zone
    Renight Bright & Smooth Ampoule

    7 x 0.07 Fl. Oz.

    SKU 412292

    Bonus Offer
    Quick View
  • 39212 420437 420437 1 Recover Touch Mask 8.45 Fl. Oz. Comfort Zone Comfort Zone Renight Professional Recover Touch Mask 8.45 Fl. Oz. False comfortzone/recovertouchmask.jpg Special Offer Available 40.50 40.50 40.50 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Renight Recover Touch Mask is a nourishing vitamin mask. True Log in to view pricing. False
    Comfort Zone Recover Touch Mask 8.45 Fl. Oz.

    Comfort Zone
    Renight Professional Recover Touch Mask

    8.45 Fl. Oz.

    SKU 420437

    Bonus Offer
    Quick View
  • 119360 811063 811063 1 super rich repair 3.4 Fl. Oz. Dermalogica Dermalogica age smart super rich repair 3.4 Fl. Oz. True dermalogica/811063dermalogicasuperrichrepairtube.jpg Special Offer Available 102.90 102.90 102.90 False False False False 102.90 False False Diversion contract is required 0 Dermalogica super rich repair is a deeply nourishing skin treatment cream. True Log in to view pricing. False
    Dermalogica super rich repair 3.4 Fl. Oz.

    Dermalogica
    age smart super rich repair

    Bonus Offer
    View Sizes
  • 127310 111449 111449 1 awaken peptide eye gel 0.5 Fl. Oz. Dermalogica Dermalogica awaken peptide eye gel 0.5 Fl. Oz. False dermalogica/dermalogicaawakenpeptideeyegel05oz.jpg Special Offer Available 41.30 41.30 41.30 False False False False 41.30 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False
    Dermalogica awaken peptide eye gel 0.5 Fl. Oz.

    Dermalogica
    awaken peptide eye gel

    0.5 Fl. Oz.

    SKU 111449

    Bonus Offer
    Quick View
  • 135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE False dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.44 0.44 0.44 False False False False 0.44 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False
    Dermalogica awaken peptide eye gel SAMPLE

    Dermalogica
    awaken peptide eye gel

    SAMPLE

    SKU 611449

    Bonus Offer
    Quick View
  • 128123 111447 111447 1 post-breakout fix 0.5 Fl. Oz. Dermalogica Dermalogica clear start post-breakout fix 0.5 Fl. Oz. False dermalogica/dermalogicaclearstartpostbreakoutfix05ozredo.jpg Special Offer Available 17.15 17.15 17.15 False False False False 17.15 False False Diversion contract is required 0 Dermalogica clear start post-breakout fix is a gel spot treatment that helps fade and brighten the post-inflammatory hyperpigmentation (aka red and dark spots) that popping pimples leaves behind. True Log in to view pricing. False
    Dermalogica post-breakout fix 0.5 Fl. Oz.

    Dermalogica
    clear start post-breakout fix

    0.5 Fl. Oz.

    SKU 111447

    Bonus Offer
    Quick View
  • 42432 111257 111257 1 stress positive eye lift 0.85 Fl. Oz. Dermalogica Dermalogica daily skin health stress positive eye lift 0.85 Fl. Oz. False dermalogica/111257dermalogicastresspositiveeyelifttube.jpg Special Offer Available 55.30 55.30 55.30 False False False False 55.30 False False Diversion contract is required 0 Dermalogica stress positive eye lift is a de-puffing eye treatment and masque. True Log in to view pricing. False
    Dermalogica stress positive eye lift 0.85 Fl. Oz.

    Dermalogica
    daily skin health stress positive eye lift

    0.85 Fl. Oz.

    SKU 111257

    Bonus Offer
    Quick View
  • 147132 111462 111462 1 deep acne invisible liquid patch 0.5 Fl. Oz. Dermalogica Dermalogica deep acne invisible liquid patch 0.5 Fl. Oz. False dermalogica/dermalogicadeepacneinvisibleliquidpatch.jpg Special Offer Available 23.80 23.80 23.80 False False False False 23.80 False False Diversion contract is required 0 Dermalogica deep acne invisible liquid patch is an invisible sulfur-based spot treatment transforms from liquid to patch to soothe, clear, and help prevent future breakouts.  True Log in to view pricing. False
    Dermalogica deep acne invisible liquid patch 0.5 Fl. Oz.

    Dermalogica
    deep acne invisible liquid patch

    0.5 Fl. Oz.

    SKU 111462

    Bonus Offer
    Quick View
  • 156435 111487 111487 1 phyto nature lifting eye cream 0.5 Fl. Oz. Dermalogica Dermalogica phyto nature lifting eye cream 0.5 Fl. Oz. True dermalogica/dermologica-phytonatureliftingeyecream0.5oz.jpg Special Offer Available 80.50 80.50 80.50 False False False False 80.50 False False Diversion contract is required 0 Dermalogica phyto nature lifting eye cream is a firming + lifting eye treatment. True Log in to view pricing. False
    Dermalogica phyto nature lifting eye cream 0.5 Fl. Oz.

    Dermalogica
    phyto nature lifting eye cream

    Bonus Offer
    View Sizes
  • 55296 211282 211282 1 PRO multi-active scaling gel 8 Fl. Oz. Dermalogica Dermalogica PRO multi-active scaling gel 8 Fl. Oz. False dermalogica/211282dermalogicapromultiactivescalinggel8oztube.jpg Special Offer Available 55.20 55.20 55.20 False False False False 55.20 False False Diversion contract is required 0 Dermalogica Professional multi-active scaling gel is a versatile, multi-purpose gel that can be used alone to facilitate extractions, or mixed with a cleanser or exfoliant for an intensified effect. True Log in to view pricing. False
    Dermalogica PRO multi-active scaling gel 8 Fl. Oz.

    Dermalogica
    PRO multi-active scaling gel

    8 Fl. Oz.

    SKU 211282

    Bonus Offer
    Quick View
(34 Items)