skin & body skin care

50999 B2830 B2830 1 1.5 Retinol Booster Sample Pack 20 ct. Skin Regimen Lx Skin Regimen Lx 1.5 Retinol Booster Sample Pack 20 ct. False comfortzone/czskinregimenretinolboosterpacket.jpg Special Offer Available 10.00 10.00 6.00 True True False False 6.00 False False Diversion contract is required 0 Skin Regimen is a modern skincare system, clinically proven to reduce the effects of stress and lifestyle aging on both skin and mind. Working at the cellular level, it recreates and maintains the optimal conditions for a healthy, youthful, glowy skin, while also empowering the overall mind-skin stress-response. Part of Step 3 of the Skin Regimen is to correct, with the 1.5 Retinol Booster / wrinkle concentrate. True Log in to view pricing. False

Skin Regimen Lx
1.5 Retinol Booster Sample Pack

20 ct.

SKU B2830

Promotional ItemLog in to view pricing.

Quick View

39074 410991 410991 1 Corrector 0.5 Fl. Oz. Comfort Zone Comfort Zone Active Pureness Corrector 0.5 Fl. Oz. False comfortzone/activepurenesscorrectorretail.jpg Special Offer Available 20.00 20.00 20.00 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Active Pureness Corrector is a targeted imperfection corrector for skin blemishes and acne prone skin. False Log in to view pricing. False

Comfort Zone
Active Pureness Corrector

0.5 Fl. Oz.

SKU 410991

Log in to view pricing.

Quick View

68043 420558 420558 1 Acid Preparator 10.14 Fl. Oz. Comfort Zone Comfort Zone Essential Professional Acid Preparator 10.14 Fl. Oz. False comfortzoneprofessional/czsublimeacid.jpg Special Offer Available 37.50 37.50 37.50 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Essential Acid Preparator. True Log in to view pricing. False

Comfort Zone
Essential Professional Acid Preparator

10.14 Fl. Oz.

SKU 420558

Log in to view pricing.

Quick View

135656 412292 412292 1 Bright & Smooth Ampoule 7 x 0.07 Fl. Oz. Comfort Zone Comfort Zone Renight Bright & Smooth Ampoule 7 x 0.07 Fl. Oz. False comfortzone/comfortzonebrightandsmoothampuleprodid135656.jpg Special Offer Available 25.00 25.00 25.00 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Renight Bright & Smooth Ampoule's offer a nighttime multivitamin concentrate with a smoothing and brightening action for the face and eye area. True Log in to view pricing. False

Comfort Zone
Renight Bright & Smooth Ampoule

7 x 0.07 Fl. Oz.

SKU 412292

Log in to view pricing.

Quick View

39212 420437 420437 1 Recover Touch Mask 8.45 Fl. Oz. Comfort Zone Comfort Zone Renight Professional Recover Touch Mask 8.45 Fl. Oz. False comfortzone/recovertouchmask.jpg Special Offer Available 40.50 40.50 40.50 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Renight Recover Touch Mask is a nourishing vitamin mask. True Log in to view pricing. False

Comfort Zone
Renight Professional Recover Touch Mask

8.45 Fl. Oz.

SKU 420437

Log in to view pricing.

Quick View

126744 420716 420716 1 Neutralizer 9.47 Fl. Oz. Comfort Zone Comfort Zone Sublime Skin Professional Neutralizer 9.47 Fl. Oz. False comfortzoneprofessional/comfortzonesublimeskinneutralizer9oz.jpg Special Offer Available 37.50 37.50 37.50 False False False False 0.00 False False Diversion contract is required 0 Comfort Zone Professional Sublime Skin Neutralizer is an arginine solution which, due to its affinity with the skin, gently neutralizes the activity of the alpha-hydroxy acids and restores the physiological skin pH. True Log in to view pricing. False

Comfort Zone
Sublime Skin Professional Neutralizer

9.47 Fl. Oz.

SKU 420716

Log in to view pricing.

Quick View

119360 811063 811063 1 super rich repair 3.4 Fl. Oz. Dermalogica Dermalogica age smart super rich repair 3.4 Fl. Oz. True dermalogica/811063dermalogicasuperrichrepairtube.jpg Special Offer Available 102.90 102.90 102.90 False False False False 102.90 False False Diversion contract is required 0 Dermalogica super rich repair is a deeply nourishing skin treatment cream. True Log in to view pricing. False

Dermalogica super rich repair 3.4 Fl. Oz.

Dermalogica
age smart super rich repair

Log in to view pricing.

View Sizes

127310 111449 111449 1 awaken peptide eye gel 0.5 Fl. Oz. Dermalogica Dermalogica awaken peptide eye gel 0.5 Fl. Oz. False dermalogica/dermalogicaawakenpeptideeyegel05oz.jpg Special Offer Available 41.30 41.30 41.30 False False False False 41.30 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

0.5 Fl. Oz.

SKU 111449

Log in to view pricing.

Quick View

135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE False dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.40 0.40 0.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

SAMPLE

SKU 611449

Log in to view pricing.

Quick View

128123 111447 111447 1 post-breakout fix 0.5 Fl. Oz. Dermalogica Dermalogica clear start post-breakout fix 0.5 Fl. Oz. False dermalogica/dermalogicaclearstartpostbreakoutfix05ozredo.jpg Special Offer Available 17.15 17.15 17.15 False False False False 17.15 False False Diversion contract is required 0 Dermalogica clear start post-breakout fix is a gel spot treatment that helps fade and brighten the post-inflammatory hyperpigmentation (aka red and dark spots) that popping pimples leaves behind. True Log in to view pricing. False

Dermalogica
clear start post-breakout fix

0.5 Fl. Oz.

SKU 111447

Log in to view pricing.

Quick View

42432 111257 111257 1 stress positive eye lift 0.85 Fl. Oz. Dermalogica Dermalogica daily skin health stress positive eye lift 0.85 Fl. Oz. False dermalogica/111257dermalogicastresspositiveeyelifttube.jpg Special Offer Available 55.30 55.30 55.30 False False False False 55.30 False False Diversion contract is required 0 Dermalogica stress positive eye lift is a de-puffing eye treatment and masque. True Log in to view pricing. False

Dermalogica
daily skin health stress positive eye lift

0.85 Fl. Oz.

SKU 111257

Log in to view pricing.

Quick View

147132 111462 111462 1 deep acne invisible liquid patch 0.5 Fl. Oz. Dermalogica Dermalogica deep acne invisible liquid patch 0.5 Fl. Oz. False dermalogica/dermalogicadeepacneinvisibleliquidpatch.jpg Special Offer Available 23.80 23.80 23.80 False False False False 23.80 False False Diversion contract is required 0 Dermalogica deep acne invisible liquid patch is an invisible sulfur-based spot treatment transforms from liquid to patch to soothe, clear, and help prevent future breakouts. True Log in to view pricing. False

Dermalogica
deep acne invisible liquid patch

0.5 Fl. Oz.

SKU 111462

Log in to view pricing.

Quick View

156435 111487 111487 1 phyto nature lifting eye cream 0.5 Fl. Oz. Dermalogica Dermalogica phyto nature lifting eye cream 0.5 Fl. Oz. True dermalogica/dermologica-phytonatureliftingeyecream0.5oz.jpg Special Offer Available 80.50 80.50 80.50 False False False False 80.50 False False Diversion contract is required 0 Dermalogica phyto nature lifting eye cream is a firming + lifting eye treatment. True Log in to view pricing. False

Dermalogica
phyto nature lifting eye cream

Log in to view pricing.

View Sizes

55296 211282 211282 1 PRO multi-active scaling gel 8 Fl. Oz. Dermalogica Dermalogica PRO multi-active scaling gel 8 Fl. Oz. False dermalogica/211282dermalogicapromultiactivescalinggel8oztube.jpg Special Offer Available 55.20 55.20 55.20 False False False False 55.20 False False Diversion contract is required 0 Dermalogica Professional multi-active scaling gel is a versatile, multi-purpose gel that can be used alone to facilitate extractions, or mixed with a cleanser or exfoliant for an intensified effect. True Log in to view pricing. False

Dermalogica
PRO multi-active scaling gel

8 Fl. Oz.

SKU 211282

Log in to view pricing.

Quick View

65542 211310 211310 1 advanced renewal peel - glycolic acid PRO 4 Fl. Oz. Dermalogica Dermalogica pro only advanced renewal peel - glycolic acid PRO 4 Fl. Oz. False dermalogica/211310dermalogicaproadvancedrenewalpeel4oztube.jpg Special Offer Available 110.40 110.40 110.40 False False False False 110.40 False False Diversion contract is required 0 A powerful peel that resurfaces skin to help fight the visible effects of AGEs to minimize the appearance of fine lines and wrinkles. Glycolic Acid, complexed with Phytic Acid and Opuntia Flower Extract reduce the appearance of hyper pigmentation, fine lines and wrinkles, and evens skin tone. True Log in to view pricing. False